PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G208800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family B3
Protein Properties Length: 335aa    MW: 37415.3 Da    PI: 10.3456
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G208800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.11.2e-1672156897
                         -HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                  B3   8 sdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                         +d l+   +++p +f++eh    +++sk  ++ ++ g+ W+v+l  ++ + +++l++GW +F  a++L eg ++vF++d+++ f  +v vf
  Seita.4G208800.1.p  72 ADDLE--KMRIPDEFVQEHlTDTHPSSKRAMIFSPLGKFWRVEL--DRDQPGVLLGDGWVRFLTAHDLSEGNILVFRYDDSMVF--TVEVF 156
                         44444..58***********66778999****************..********************************998999..77776 PP

2B352.21.1e-162493301095
                         HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         +l+s ++ +  +f+++ g+  ++++tl+ +  + rsW+v+++ + +  +y+ ++GWk+F+++n+LkegD+++F+++++  +  +v+
  Seita.4G208800.1.p 249 NLTS-LFAVKGSFCSSVGLAGACEITLKTKMGNTRSWRVRFN-TTNTYGYITGQGWKRFCRENKLKEGDSCTFSVIET--TVWHVT 330
                         4444.4788899**99999977765555555555*******4.334446999**********************7764..333555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.86E-1962161IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-1962161IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.39463159IPR003340B3 DNA binding domain
CDDcd100178.63E-1664156No hitNo description
SMARTSM010192.6E-1166159IPR003340B3 DNA binding domain
PfamPF023629.8E-1474156IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-21237332IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.71E-17238332IPR015300DNA-binding pseudobarrel domain
CDDcd100176.16E-13239331No hitNo description
SMARTSM010191.1E-9241334IPR003340B3 DNA binding domain
PfamPF023623.7E-14254324IPR003340B3 DNA binding domain
PROSITE profilePS5086312.224271334IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAPLVRRARP KYAAALLSPT CLHKLRGVQA RAARVATLRA FDAAGCLARF CTPLAGVAAG  60
KNRPRFIRVL NADDLEKMRI PDEFVQEHLT DTHPSSKRAM IFSPLGKFWR VELDRDQPGV  120
LLGDGWVRFL TAHDLSEGNI LVFRYDDSMV FTVEVFMQSG CLKEYEAATA DMTDDAIGRQ  180
ITVPQQGDKE LCVSPVKKKR KTRNENTCLA VYRKKPNHSP ISVKKAVSQK KLVSIEPRHS  240
FTKRITGYNL TSLFAVKGSF CSSVGLAGAC EITLKTKMGN TRSWRVRFNT TNTYGYITGQ  300
GWKRFCRENK LKEGDSCTFS VIETTVWHVT IVSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196214KKKRKTRNENTCLAVYRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700752.11e-158PREDICTED: putative B3 domain-containing protein Os06g0632500
SwissprotQ67VL71e-108Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLK3Y2K30.0K3Y2K3_SETIT; Uncharacterized protein
STRINGSi008427m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.12e-17B3 family protein